A Novel Class IIb Bacteriocin-Plantaricin EmF Effectively Inhibits Listeria monocytogenes and Extends the Shelf Life of Beef in Combination with Chitosan

J Agric Food Chem. 2022 Feb 23;70(7):2187-2196. doi: 10.1021/acs.jafc.1c06269. Epub 2022 Jan 12.

Abstract

Plantaricin EmF separated and identified from L. plantarum 163 was a novel class IIb bacteriocin. The molecular masses of plantaricin Em and F were 1638 and 3702 Da, respectively, with amino acid sequences FNRGGYNFGKSVRH and VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG, respectively. Plantaricin EmF not only exhibited broad-pH adaptability and thermostability but also showed high efficiency and broad-spectrum antibacterial activity. Its mode of action on L. monocytogenes damaged cell membrane integrity, resulting in the leakage of cytoplasm, changes in cell structure and morphology, and ultimately cell death. Additionally, plantaricin EmF inactivated L. monocytogenes in beef, effectively improving the quality indices of beef, thereby extending its shelf life, especially in combination with chitosan. Plantaricin EmF + 1.0% chitosan extended the shelf life of beef to 15 d, demonstrating its potential application value to replace chemical preservatives to control food-borne pathogenic microorganisms and extend the shelf life of meat and meat products in agriculture and the food industry.

Keywords: Listeria monocytogenes; beef; biopreservation; chitosan; plantaricin EmF.

MeSH terms

  • Animals
  • Bacteriocins* / pharmacology
  • Cattle
  • Chitosan* / pharmacology
  • Food Microbiology
  • Listeria monocytogenes*
  • Meat / microbiology
  • Meat Products* / microbiology

Substances

  • Bacteriocins
  • Chitosan