Isolation, characterization and biological activity of acidic phospholipase A2 isoforms from Bothrops jararacussu snake venom

Biochimie. 2003 Oct;85(10):983-91. doi: 10.1016/j.biochi.2003.09.011.

Abstract

Acidic phospholipase A(2) (PLA(2)) isoforms in snake venoms, particularly those from Bothrops jararacussu, have not been characterized. This article reports the isolation and partial biochemical, functional and structural characterization of four acidic PLA(2)s (designated SIIISPIIA, SIIISPIIB, SIIISPIIIA and SIIISPIIIB) from this venom. The single chain purified proteins contained 122 amino acid residues and seven disulfide bonds with approximate molecular masses of 15 kDa and isoelectric points of 5.3. The respective N-terminal sequences were: SIIISPIIA-SLWQFGKMIDYVMGEEGAKS; SIIISPIIB-SLWQFGKMIFYTGKNEPVLS; SIIISPIIIA-SLWQFGKMILYVMGGEGVKQ and SIIISPIIIB-SLWQFGKMIFYEMTGEGVL. Crystals of the acidic protein SIIISPIIB diffracted beyond 1.8 A resolution. These crystals are monoclinic with unit cell dimensions of a = 40.1 A, b = 54.2 A and c = 90.7 A. The crystal structure has been refined to a crystallographic residual of 16.1% (R(free) = 22.9%). Specific catalytic activity (U/mg) of the isolated acidic PLA(2)s were SIIISPIIA = 290.3 U/mg; SIIISPIIB = 279.0 U/mg; SIIISPIIIA = 270.7 U/mg and SIIISPIIIB = 96.5 U/mg. Although their myotoxic activity was low, SIIISPIIA, SIIISPIIB and SIIISPIIIA showed significant anticoagulant activity. However, there was no indirect hemolytic activity. SIIISPIIIB revealed no anticoagulant, but presented indirect hemolytic activity. With the exception of SIIISPIIB, which inhibited platelet aggregation, all the others were capable of inducing time-independent edema. Chemical modification with 4-bromophenacyl bromide did not inhibit the induction of edema, but did suppress other activities.

Publication types

  • Research Support, Non-U.S. Gov't

MeSH terms

  • Amino Acid Sequence
  • Animals
  • Bothrops*
  • Creatine Kinase / metabolism
  • Crotalid Venoms / chemistry
  • Crotalid Venoms / enzymology*
  • Crotalid Venoms / toxicity
  • Crystallography, X-Ray
  • Edema / chemically induced
  • In Vitro Techniques
  • Isoenzymes / chemistry
  • Isoenzymes / isolation & purification
  • Isoenzymes / pharmacology
  • Mice
  • Models, Molecular
  • Molecular Sequence Data
  • Muscles / drug effects
  • Phospholipases A / chemistry*
  • Phospholipases A / isolation & purification
  • Phospholipases A / pharmacology
  • Phospholipases A / toxicity
  • Phospholipases A2
  • Platelet Aggregation Inhibitors / chemistry
  • Platelet Aggregation Inhibitors / isolation & purification
  • Platelet Aggregation Inhibitors / pharmacology
  • Protein Conformation

Substances

  • Crotalid Venoms
  • Isoenzymes
  • Platelet Aggregation Inhibitors
  • Creatine Kinase
  • Phospholipases A
  • Phospholipases A2