Crucial role of position 40 for interactions of CCK-58 revealed by sequence of cat CCK-58

Biochem Biophys Res Commun. 2006 Sep 29;348(3):819-25. doi: 10.1016/j.bbrc.2006.07.081. Epub 2006 Jul 28.

Abstract

Evidence suggests that amino terminal extensions of CCK-8 affect the carboxyl terminal bioactive region of CCK. Cat CCK-58 was purified by low pressure reverse phase and ion-exchange chromatography steps and several reverse phase HPLC steps. The purified peptide and its tryptic fragments were characterized by mass spectral analysis and microsequence analysis. The structure of cat CCK-58 is: AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDY(SO3) MGWMDF-amide. Cat and dog CCK-58 are identical except for position 40 which is serine in cat and asparagine in dog. Radioimmunoassay detected cat CCK-58 about 1/10th as well as dog CCK-58, indicating a marked effect on C-terminal immunoreactivity. Cat CCK-58 with a serine at position 40, the same residue found in pig, mouse, cow and rabbit CCK-58, can be used as a unique bioprobe for defining how amino terminal amino acids influence the structure and bioactivity of the carboxyl terminal region of CCK.

Publication types

  • Comparative Study
  • Research Support, N.I.H., Extramural
  • Research Support, Non-U.S. Gov't

MeSH terms

  • Amino Acid Sequence
  • Animals
  • Cats
  • Cholecystokinin / chemistry*
  • Cholecystokinin / genetics
  • Cholecystokinin / metabolism*
  • Dogs
  • Male
  • Molecular Sequence Data
  • Protein Interaction Mapping*
  • Protein Structure, Tertiary / physiology
  • Sequence Analysis, Protein*
  • Serine / metabolism

Substances

  • Serine
  • cholecystokinin 58
  • Cholecystokinin