A defensin-like antimicrobial peptide from the venoms of spider, Ornithoctonus hainana

J Pept Sci. 2011 Jul;17(7):540-4. doi: 10.1002/psc.1370. Epub 2011 Apr 28.

Abstract

The defensin-like antimicrobial peptides have been characterized from various other arthropods including insects, scorpions, and ticks. But no natural spider defensin-like antimicrobial peptides have ever been isolated from spiders, except couple of cDNA and DNA sequences of five spider species revealed by previous genomic study. In this work, a defensin-like antimicrobial peptide named Oh-defensin was purified and characterized from the venoms of the spider, Ornithoctonus hainana. Oh-defensin is composed of 52 amino acid (aa) residues including six Cys residues that possibly form three disulfide bridges. Its aa sequence is MLCKLSMFGAVLGV PACAIDCLPMGKTGGSCEGGVCGCRKLTFKILWDKKFG. By BLAST search, Oh-defensin showed significant sequence similarity to other arthropod antimicrobial peptides of the defensin family. Oh-defensin exerted potent antimicrobial activities against tested microorganisms including Gram-positive bacteria, Gram-negative bacteria, and fungi. The cDNA encoding Oh-defensin precursor was also cloned from the cDNA library of O. hainana.

Publication types

  • Research Support, Non-U.S. Gov't

MeSH terms

  • Amino Acid Sequence
  • Animals
  • Antimicrobial Cationic Peptides / chemistry*
  • Antimicrobial Cationic Peptides / genetics
  • Antimicrobial Cationic Peptides / isolation & purification*
  • Antimicrobial Cationic Peptides / pharmacology
  • Bacteria / drug effects
  • Base Sequence
  • Defensins / chemistry*
  • Defensins / genetics
  • Defensins / isolation & purification*
  • Defensins / pharmacology
  • Fungi / drug effects
  • Hemolysis / drug effects
  • Insect Proteins / chemistry
  • Insect Proteins / genetics
  • Insect Proteins / isolation & purification
  • Microbial Sensitivity Tests
  • Molecular Sequence Data
  • Spider Venoms / chemistry*
  • Spiders*

Substances

  • Antimicrobial Cationic Peptides
  • Defensins
  • Insect Proteins
  • Spider Venoms