Abstract
An identical CRF-related diuretic peptide (Musca-DP) was isolated and characterized from whole-body extracts of the house fly, Musca domestica, and stable fly, Stomoxys calcitrans. The peptide stimulates cyclic AMP production in Manduca sexta Malpighian tubules and increases the rate of fluid secretion by isolated Musca domestica tubules. The 44-residue peptide, with a mol.wt. of 5180, is amidated, and has the primary structure: NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV-NH2. Musca-DP has a high percentage of sequence identity with other characterized CRF-related insect diuretic peptides.
Publication types
-
Comparative Study
-
Research Support, Non-U.S. Gov't
MeSH terms
-
Amino Acid Sequence
-
Animals
-
Corticotropin-Releasing Hormone / analogs & derivatives*
-
Cyclic AMP / metabolism
-
Diuretics / chemistry*
-
Diuretics / isolation & purification
-
Diuretics / pharmacology
-
Houseflies / chemistry
-
Malpighian Tubules / drug effects
-
Manduca / drug effects
-
Mass Spectrometry
-
Molecular Sequence Data
-
Muscidae / chemistry*
-
Peptides / chemistry*
-
Peptides / isolation & purification
-
Peptides / pharmacology
-
Sequence Analysis
-
Sequence Homology, Amino Acid
Substances
-
Diuretics
-
Peptides
-
Corticotropin-Releasing Hormone
-
Cyclic AMP